PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000025-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 523aa    MW: 58954 Da    PI: 5.953
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000025-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.34.9e-062759335
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                   e++C+ + e +   +C+ +  +lC +C +  H+
  NNU_000025-RA 27 EKVCEFCAESKPVVYCKADAAYLCLSCDSRVHS 59
                   789******99******************9995 PP

2CCT56.69e-20468509243
            CCT   2 eaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                    e+a+ RYkeK+  R +eK+irY+sRKa+A+ R+RvKGrFvk+
  NNU_000025-RA 468 ENAMIRYKEKKMARTYEKRIRYASRKATADVRKRVKGRFVKA 509
                    68999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.6E-102572IPR000315B-box-type zinc finger
PROSITE profilePS501199.1292572IPR000315B-box-type zinc finger
CDDcd000211.05E-52972No hitNo description
PROSITE profilePS501198.54668112IPR000315B-box-type zinc finger
CDDcd000215.64E-472102No hitNo description
SMARTSM003365.173112IPR000315B-box-type zinc finger
PROSITE profilePS5101714.356467509IPR010402CCT domain
PfamPF062037.5E-15468509IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
METPKEKLKQ QRNVSRRANG LETKKMEKVC EFCAESKPVV YCKADAAYLC LSCDSRVHSA  60
NSLSEKHFRA LLCDGCRNHP AYSRCLDHRM LMCHGCDQKL HAIDSQHKKR AMSSYRGCPS  120
ARDFAVLWGY DLNELCASGF QDQLVSASSG SLSPSVANLD IARNLCPLTE VSSLTEVESN  180
SLQGTQRETC IILQQILDLE RLQLTERKSH SSLIRAEMQA DIYSSKNNNS GPLGEDLDHN  240
FLNPQGLSID IQQMDRMNHE LQVQPFPLPF SQLELLNSSS SSEIPLHGDI YWQCKSPAQT  300
SQLWTQTMED LEICEETVCN DDFNIPDVDL TFQNYEELFS GDQDHIRSLF GEKDIGFSSM  360
DKDISLEKSD NGYSRAIEDI SVVPSVYVSQ SSHQYKSIGH SDQSYQIGGS MDSHHLIRPS  420
YSCLPFSVSR LSAESSASDC LDSGISPNTI QASWNSPDVE NTHSEAKENA MIRYKEKKMA  480
RTYEKRIRYA SRKATADVRK RVKGRFVKAE VYESDTINMT RSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248374.10.0PREDICTED: putative zinc finger protein At1g68190
RefseqXP_010248278.10.0PREDICTED: putative zinc finger protein At1g68190
RefseqXP_010247709.10.0PREDICTED: putative zinc finger protein At1g68190
RefseqXP_010247033.10.0PREDICTED: putative zinc finger protein At1g68190
TrEMBLA0A061E5V41e-173A0A061E5V4_THECC; B-box zinc finger family protein, putative isoform 2
STRINGPOPTR_0008s12410.11e-130(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.13e-28B-box type zinc finger protein with CCT domain